Recombinant human TLR4 protein
Cat no : Ag13857
Synonyms
TLR4, ARMD10, CD284, hToll, TOLL
Validation Data Gallery View All
Product Information
| Peptide Sequence |
KFYFHLMLLAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAANIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLRQQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI
(653-839 aa encoded by BC117422) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
| Species | Title |
|---|---|
J Ethnopharmacol Dendropanax proteus root and its major bio-phytochemicals alleviate rheumatoid arthritis by inhibiting TLR4/CLEC1B/PI3K/Akt/NF-κB pathways: proteomics, metabolomics, collagen-induced arthritis rats, MH7A cells, molecular docking, and molecular dynamic simulation. |
