Recombinant human FOSL1 protein
Cat no : Ag25788
Synonyms
FOSL1, FOS like antigen 1, Fos related antigen 1, Fos-related antigen 1, FRA
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL
(1-271 aa encoded by BC016648) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
| Species | Title |
|---|---|
Theranostics Targeting the FOSL1/IKKα positive feedback loop attenuates glioblastoma malignancy via suppression of NF-κB signaling. | |
J Transl Med Dynamic remodelling of epithelial plasticity in colorectal cancer from single-cell and spatially resolved perspectives. |
