Validation Data Gallery
Product Information
The ChromoTek Strep-NanoTrap Agarose Kit consists of an anti-Strep-tag® Nanobody/VHH, which is coupled to agarose beads. It also contains lysis, wash, and elution buffers that can be used for the immunoprecipitation of Strep-tagged proteins from cell extracts of various organisms.
| Description | The Strep-Trap Agarose Kit contains Strep-Trap agarose, lysis, wash, and elution buffers for efficient immunoprecipitation of Strep-tagged proteins.  • Fast, reliable & efficient one-step immunoprecipitation  • Ready-to-use  • No heavy & light antibody chains  • Stable under harsh washing conditions  • Suitable for downstream mass spec analysis | 
| Applications | IP, Co-IP | 
| Specificity/Target | Binds specifically to the peptide sequence SAWSHPQFEK, also known as Strep-Tag® or Strep-TagII®, fused to a protein of interest at N- or C-terminal position. In addition, this trap binds to the peptide sequence SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK, also known as Twin-Strep-Tag®, fused to a protein of interest at N- or C-terminal position. | 
| Binding Capacity | 25 ug of recombinant SAWSHPQFEK-tagged protein (~30 kDa) per 25 uL bead slurry | 
| Conjugate | Agarose beads; ~90 um (cross-linked 4% agarose beads) | 
| Elution buffer | 2x SDS-sample buffer (Lammli) | 
| Wash Buffer Compatibility | 1M NaCl, 5 mM DTT, 5 mM β-mercaptoethanol, 5 mM TCEP, 2% NP40, 2% Triton X-100, 0.1% SDS, 2-3 M Urea | 
| Type | Nanobody | 
| Class | Recombinant | 
| Host | Alpaca | 
| Affinity (KD) | 480 nM for N-terminal Strep-Tag® and 600 nM for C-terminal Strep-Tag® | 
| Compatibility with mass spectrometry | The Strep-Trap is optimized for on-bead digestion. For the application note, please click here: On-bead digest protocol for mass spectrometry | 
| RRID | AB_3107051 | 
| Storage Buffer | 20% ethanol | 
| Storage Condition | Shipped at ambient temperature. Upon receipt store at +4°C. Stable for one year. DO not freeze! | 
Kit components
| Component | Description | 
|---|---|
| Strep-NanoTrap Agarose | 20 reactions (500 µl) | 
| Lysis buffer | Optimized for cytoplasmic proteins and mammalian cell lysis | 
| RIPA buffer | Optimized for nuclear/chromatin proteins and mammalian cell lysis | 
| Wash buffer | Removal of unwanted proteins, peptides, etc. | 
| Dilution buffer | Dilution of cell lysate | 
| Elution buffer | For acidic elution | 
Documentation
| SDS | 
|---|
| qtak_SDS_HA-Trap Agarose Kit (EN) | 
| Datasheet | 
|---|
| Strep-NanoTrap Agarose, Kit for Immunoprecipitation Datasheet | 


