Recombinant human PI3 protein
Cat no : Ag8968
Synonyms
ESI; MGC13613; SKALP; WAP3; WFDC14; cementoin
Validation Data Gallery View All
Product Information
| Peptide Sequence |
AAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
(22-117aa encoded by BC010952) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
| Species | Title |
|---|---|
Pharmaceuticals (Basel) Metabolites from the Dendrobium Endophyte Pseudomonas protegens CM-YJ44 Alleviate Insulin Resistance in HepG2 Cells via the IRS1/PI3K/Akt/GSK3β/GLUT4 Pathway |
