Recombinant mouse Tnfa protein
Cat no : Ag24089
Synonyms
Tnf, Tnfa, DIF, TNF a, TNF alpha
Validation Data Gallery View All
Product Information
Peptide Sequence |
MSTESMIRDVELAEEALPQKMGGFQNSRRCLCLSLFSFLLVAGATTLFCLLNFGVIGPQRDEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
(1-235 aa encoded by NM-013693) |
Activity | Not tested. |
Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
Species | Title |
---|---|
Scand J Immunol Acacetin regulated the reciprocal differentiation of Th17 cells and Treg cells and mitigated the symptoms of collagen-induced arthritis in mice. | |
Nat Immunol Ammonia detoxification promotes CD8+ T cell memory development by urea and citrulline cycles |