Recombinant human TM4SF4 protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Liquid
Species
human
Cat no : Ag24459
Synonyms
TM4SF4, ILTMP
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MCTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGGILGSGVLMIFPALVFLGLKNND
(1-73 aa encoded by BC001386) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
