Recombinant human TCEAL8 protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Liquid
Species
human
Cat no : Ag11606
Synonyms
TCEAL8, TCEA L8, TCEA-like protein 8, Transcription elongation factor A protein-like 8, Transcription elongation factor S-II protein-like 8
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MQKSCEENEGKPQNMPKAEEDRPLEDVPQEAEGNPQPSEEGVSQEAEGNPRGGPNQPGQGFKEDTPVRHLDPEEMIRGVDELERLREEIRRVRNKFVMMHWKQRHSRSRPYPVCFRP
(1-117 aa encoded by BC035573) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
