Recombinant human Synaptophysin; SYP protein
Cat no : Ag11781
Synonyms
Synaptophysin, SYP, MRX96, SYN
Validation Data Gallery View All
Product Information
| Peptide Sequence |
ELQLSVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDLVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM
(50-313 aa encoded by BC064550) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
| Species | Title |
|---|---|
Nat Neurosci Aerobic glycolysis is the predominant means of glucose metabolism in neuronal somata, which protects against oxidative damage |
