Recombinant human STT3A protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Species
human
Cat no : Ag31994
Synonyms
STT3A, B5, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A, EC:2.4.99.18, Integral membrane protein 1
Validation Data Gallery View All
Product Information
| Peptide Sequence |
THISRVGQAMASTEEKAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMV
(550-600 aa encoded by BC020965) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
