Recombinant human STEAP4 protein
Source
e coli.-derived, PKG
Tag
GST
Format
Liquid
Species
human
Cat no : Ag28030
Synonyms
STEAP4, EC:1.16.1.-, Metalloreductase STEAP4, Six-transmembrane epithelial antigen of prostate 4, STAMP2
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MEKTCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEAAKKSGIIIIAIHREHYDFLTELTEVLNGKILVDISNNLKINQYPESNAEYLAHLVPGAHVVKAFNTISAWALQSGALDASRQAILKKENPFSTSSAWLSDSYVALGILGFFLFVLLGITSLPSVSNAVNWREFRFVQSKLGYLTLILCTAHTLVYGGKRFLSPSNLRWYLPAAYVLGLIIPCTVLVIKFVLIMPCVDNTLTRIRQGWERNSKH
(1-283 aa encoded by BC020600) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
