Recombinant human SRGN protein
Cat no : Ag2996
Synonyms
FLJ12930; MGC9289; PPG; PRG; PRG1
Validation Data Gallery View All
Product Information
Peptide Sequence |
SSVQGYPTQRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML
(23-158 aa encoded by BC015516) |
Activity | Not tested. |
Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
Species | Title |
---|---|
Sci Rep A microfluidic device for studying chemotaxis mechanism of bacterial cancer targeting. |