Recombinant human SLCO5A1 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Species
human
Cat no : Ag22652
Synonyms
SLCO5A1, OATP J, OATP RP4, OATP5A1, OATPJ
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MDEGTGLQPGAGEQLEAPATAEAVQERCEPETLRSKSLPVLSSASCRPSLSPTSGDANPAFGCVDSSGHQELKQGPNPLAPSPSAPSTSAGLGDCNHRVDLSKTFSVSSALAMLQERRCLYVVLTDSR
(1-128 aa encoded by BC137424) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
