Recombinant human SLC10A2 protein
Cat no : Ag18808
Synonyms
ASBT, SLC10A2, Apical sodium-dependent bile acid transporter, IBAT, Ileal sodium-dependent bile acid transporter
Validation Data Gallery View All
Product Information
| Peptide Sequence |
IYSIFQLAFAAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK
(292-348 aa encoded by BC130523) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
| Species | Title |
|---|---|
mBio Intestinal epithelial Tet2 deficiency reprograms the gut microbiota through bile acid metabolic alterations. |
