Recombinant human SIAE protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Liquid
Species
human
Cat no : Ag26997
Synonyms
CSE-C; LSE; MGC87009; YSG2
Validation Data Gallery View All
Product Information
| Peptide Sequence |
IEDWRETFHRGSQGQTERFFPFGLVQLSSDLSKKSSDDGFPQIRWHQTADFGYVPNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIELLAHKGLLNLTYYQQIQVQKKDNKIFEISCCSDHRC
(297-449 aa encoded by BC068450) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
