Recombinant human SH2D1B protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Species
human
Cat no : Ag2454
Synonyms
SH2D1B, EAT 2, EAT2, EAT-2, EWS/FLI1-activated transcript 2
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP
(1-132 aa encoded by BC022407) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
