Recombinant human S100P protein
Cat no : Ag19115
Synonyms
S100P, Migration-inducing gene 9 protein, Protein S100 P, Protein S100-E, Protein S100-P
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
(1-95 aa encoded by BC006819) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
| Species | Title |
|---|---|
Exp Ther Med Proof-of-concept study investigating the role of S100P-RAGE in nasopharyngeal carcinoma. |
