Recombinant human S100B protein
Cat no : Ag27086
Synonyms
S100 beta, S100B, Protein S100 B, Protein S100-B, S100 calcium-binding protein B
Validation Data Gallery View All
Product Information
| Peptide Sequence |
EQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
(50-92 aa encoded by BC001766) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
| Species | Title |
|---|---|
Biosensors (Basel) Vertically-Ordered Mesoporous Silica Film Based Electrochemical Aptasensor for Highly Sensitive Detection of Alpha-Fetoprotein in Human Serum | |
Front Chem A reagentless electrochemical immunosensor for sensitive detection of carcinoembryonic antigen based on the interface with redox probe-modified electron transfer wires and effectively immobilized antibody |
