Recombinant human RNF144B protein
Source
e coli.-derived, PET30a
Tag
6*His
Format
Liquid
Species
human
Cat no : Ag24635
Synonyms
IBRDC2, RNF144B, RNF144B/IBRDC2, E3 ubiquitin-protein ligase RNF144B, EC:2.3.2.31
Validation Data Gallery View All
Product Information
| Peptide Sequence |
VADCQTVCPVASSDPGQPVLVECPSCHLKFCSCCKDAWHAEVSCRDSQPIVLPTEHRALFGTDAE
(123-187 aa encoded by BC063311) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
