Recombinant human RBBP6 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Species
human
Cat no : Ag2484
Synonyms
RBBP6, E3 ubiquitin-protein ligase RBBP6, EC:2.3.2.27, MY038, P2P R
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNALIPKNSSVIVRRIPIGGVKSTSKTYVISRTEPAMATTKAVCKNTISHFFYTLLLPL
(1-118 aa encoded by BC029352) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
