Recombinant human RASSF1 protein
Cat no : Ag15652
Synonyms
RASSF1, Ras association domain-containing protein 1, RDA32
Validation Data Gallery View All
Product Information
Peptide Sequence |
LPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERAERHGQVYLRKLLDDEQPLRL
(210-272 aa encoded by BC110412) |
Activity | Not tested. |
Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
Species | Title |
---|---|
EMBO J Asparagine reinforces mTORC1 signaling to boost thermogenesis and glycolysis in adipose tissues. |