Recombinant human PRKAG1 protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Powder
Species
human
Cat no : Ag28907
Synonyms
AMPK Gamma 1, PRKAG1, 5'-AMP-activated protein kinase subunit gamma-1, AMPK gamma1, AMPK subunit gamma 1
Validation Data Gallery View All
Product Information
| Peptide Sequence | 
                                    LYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQA
                                     (165-321 aa encoded by BC000358)  | 
                            
| Activity | Not tested. | 
| Endotoxin Level | 
                                    Please contact the lab for more information.
                                     Note:Remove endotoxin and sterilization is required for cell assay.  | 
                            
| Purity | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Formulation | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. | 
Reconstitution and Storage
| Reconstitution | 
                                    Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
                                     After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.  | 
                            
| Shipping | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below). | 
| Stability and Storage | Store for up to 12 months at -20°C to -80°C as lyophilized powder. | 
| Storage of Reconstituted Protein | 
                                    Short-term storage: Store at 2-8°C for (1-2 weeks).
                                     Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.  | 
                            
