Recombinant human PKLR protein

Source

e coli.-derived, PET28a

Tag

6*His

Format

Liquid

Species

human

Cat no : Ag17884

Synonyms

PKLR, EC:2.7.1.40, PK1, PKL, Pyruvate kinase isozymes L/R



Product Information

Peptide Sequence PLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVT
(446-556 aa encoded by BC025737)
Activity Not tested.
Endotoxin Level Please contact the lab for more information.

Note:Remove endotoxin and sterilization is required for cell assay.

Formulation The protein was expressed as 6xHis-tagged fusion protein by E.Coli and purified by Ni-sepharose. The purified protein was resolved in PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4 ) added with 15% glycerol. The elution buffer contain 300mM imidazole.