Recombinant human PAX8 protein
Cat no : Ag0306
Synonyms
PAX8, PAX-8, paired box 8, Paired box protein Pax 8, Paired box protein Pax-8
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDS
(1-212 aa encoded by BC001060) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
| Species | Title |
|---|---|
Histopathology Tumour-to-tumour Metastasis from Papillary Thyroid Carcinoma with BRAF mutation to Lung Adenocarcinoma with EGFR mutation: The Utility of Mutation-specific Antibodies. |
