Recombinant human NKX2-3 protein
Cat no : Ag25216
Synonyms
CSX3; NK2.3; NKX2.3; NKX2C; NKX4-3
Validation Data Gallery View All
Product Information
| Peptide Sequence |
NLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFSDGGEEDEEDEGEKLSYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDRSQKSCQLKKSLETAGDCKAAEESERPKPRSR
(19-148 aa encoded by BC025788) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
| Species | Title |
|---|---|
Nat Commun Pericytes promote metastasis by regulating tumor local vascular tone and hemodynamics |
