Recombinant human NGF protein
Cat no : Ag25370
Synonyms
Beta NGF, NGF, Beta nerve growth factor, Beta-nerve growth factor, Beta-NGF
Validation Data Gallery View All
Product Information
| Peptide Sequence |
GRVGAGSRRGAQRVLASGRAVQGAGWHAGPKLSSASGPNNSFTKGAAFYPGHTEVHSVMSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
(1-299 aa encoded by BC032517) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
| Species | Title |
|---|---|
J Exp Clin Cancer Res Hedgehog-Gli1-derived exosomal circ-0011536 mediates peripheral neural remodeling in pancreatic cancer by modulating the miR-451a/VGF axis | |
J Orthop Surg Res Pain mediator NGF improves chondrocyte extracellular matrix synthesis via PI3K/AKT pathway |
