Recombinant human MTAP protein
Cat no : Ag17954
Synonyms
MTAP, 5'-methylthioadenosine phosphorylase, c86fus, EC:2.4.2.28, MSAP
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATCRTMS
(1-154 aa encoded by BC018625) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
| Species | Title |
|---|---|
Diagn Cytopathol Investigation of MTAP and BAP1 staining loss and P16/CDKN2A deletion in pleural cytology specimens and its role in the diagnosis of mesothelioma |
