Recombinant human LSM7 protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Liquid
Species
human
Cat no : Ag13498
Synonyms
LSM7, U6 snRNA-associated Sm-like protein LSm7, YNL147W
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA
(1-103 aa encoded by BC018621) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
