Recombinant human KLRD1 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Species
human
Cat no : Ag4142
Synonyms
CD94, Killer cell lectin-like receptor subfamily D member 1, KLRD1, KP43, NK cell receptor
Validation Data Gallery View All
Product Information
| Peptide Sequence |
TKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI
(36-179 aa encoded by BC028009) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
