Recombinant human JAK1 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Species
human
Cat no : Ag25579
Synonyms
JAK1, EC:2.7.10.2, JAK 1, JAK-1, JAK1A
Validation Data Gallery View All
Product Information
| Peptide Sequence |
SDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEA
(1080-1151 aa encoded by BC132729) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
