Recombinant human ITGB1BP1 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Species
human
Cat no : Ag2945
Synonyms
ITGB1BP1, ICAP 1, ICAP1, ICAP-1, Integrin beta-1-binding protein 1
Validation Data Gallery View All
Product Information
| Peptide Sequence |
RHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEKLKLSEGKGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGVGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP
(8-200 aa encoded by BC012264) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
