Recombinant human IL-6 protein
Cat no : Ag13767
Synonyms
IL6, IL-6, B-cell stimulatory factor 2, IFN-beta-2, IL 6
Validation Data Gallery View All
Product Information
| Peptide Sequence |
PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
(29-212 aa encoded by BC015511) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
| Species | Title |
|---|---|
Cell Signal IL-6/KIAA1429 promotes ferroptosis resistance in endometrial cancer through m6A modification of DDIT3 |
