Recombinant human IFNG protein
Cat no : Ag8321
Synonyms
IFNG, IFG, IFN gamma, IFN γ, IFN-gamma
Validation Data Gallery View All
Product Information
| Peptide Sequence |
YCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
(22-166 aa encoded by BC070256) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
| Species | Title |
|---|---|
FASEB J Corilagin enhances wound healing by modulating the macrophage phenotype in diabetic mice |
