Recombinant human ID2 protein
Cat no : Ag27134
Synonyms
GIG8; ID2A; ID2H; MGC26389; bHLHb26
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
(1-134 aa encoded by BC030639) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
| Species | Title |
|---|---|
Mol Neurobiol SnRNA-seq Interprets Mechanisms by which Three Glial Cell Types Influence Myelin Regeneration in Adult Drug-Resistant Epilepsy-Related Cognitive Impairment |
