Recombinant human Histone H2A.X protein
Cat no : Ag19289
Synonyms
H2AFX, H2A histone family, member X, H2A.X, H2AX, Histone H2A
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
(1-143 aa encoded by BC013416) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
| Species | Title |
|---|---|
Bioorg Chem FL118: A potential bladder cancer therapeutic compound targeting H2A.X identified through library screening |
