Recombinant human Histone H2A.X protein
Cat no : Ag19289
Synonyms
H2A, H2AFX, H2A histone family, member X, H2A.X, H2AX
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
(1-143 aa encoded by BC013416) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
| Species | Title |
|---|---|
Bioorg Chem FL118: A potential bladder cancer therapeutic compound targeting H2A.X identified through library screening | |
Microbiol Res Dynamic regulation of K33- and K48-linked ubiquitination of Tip60 by TRIM37 orchestrates host DNA damage response during Pseudomonas aeruginosa infection and recovery. |
