Recombinant human GGA1 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Species
human
Cat no : Ag22605
Synonyms
GGA1, ADP-ribosylation factor-binding protein GGA1, Gamma-adaptin-related protein 1, Golgi-localized, gamma ear-containing, ARF-binding protein 1
Validation Data Gallery View All
Product Information
| Peptide Sequence |
ALGLSDPTPPSGPSLDGTGWNSFQSSDATEPPAPALAQAPSMESRPPAQTSLPASSGLDDLDLLGKTLLQQSLPPESQQVRWEKQQPTPRLTLRDLQNKSSSCSSPSSSATSLLHTVSPE
(276-395 aa encoded by BC044629) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
