Recombinant human FXYD6 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Species
human
Cat no : Ag8538
Synonyms
FXYD6, FXYD domain-containing ion transport regulator 6, Phosphohippolin, UNQ521/PRO1056
Validation Data Gallery View All
Product Information
| Peptide Sequence |
KEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRAPGDEEAQVENLITANATEPQKAEN
(23-95 aa encoded by BC018652) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
