Recombinant human FOS protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Liquid
Species
human
Cat no : Ag24357
Synonyms
c-Fos, FOS, AP 1, C FOS, Cellular oncogene fos
Validation Data Gallery View All
Product Information
| Peptide Sequence |
ILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSF
(196-341 aa encoded by BC004490) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
