Recombinant human FER protein
Cat no : Ag18173
Synonyms
FER, EC:2.7.10.2, Feline encephalitis virus-related kinase FER, Fujinami poultry sarcoma/Feline sarcoma-related protein Fer, p94 Fer
Validation Data Gallery View All
Product Information
| Peptide Sequence |
PLHRLTMMIKDKQQVKKSYIGVHQQIEAEMIKVTKTELEKLKCSYRQLIKEMNSAKEKYKEALAKGKETEKAKERYDKATMKLHMLHNQYVLALKGAQLHQNQYYDITLPLLLDSLQKMQEEMIKALKGIFDEYSQITSLVTEEIVNVHKEIQMSVEQIDPSTEYNNFIDVHRTTAAKEQEIEFDTSLLEENENLQANEIMWNNLTAESLQVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSKFESIRHSIAGIIRSPKSALGSSALS
(96-445 aa encoded by BC017060) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
| Species | Title |
|---|---|
Cell Signal IL-6/KIAA1429 promotes ferroptosis resistance in endometrial cancer through m6A modification of DDIT3 |
