Recombinant human FBXW7 protein
Cat no : Ag28471
Synonyms
FBXW7, CDC4, F-box and WD-40 domain-containing protein 7, F-box protein FBX30, F-box/WD repeat-containing protein 7
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MNQELLSVGSKRRRTGGSLRGNPSSSQVDEEQMNRVVEEEQQQQLRQQEEEHTARNGEVVGVEPRPGGQNDSQQGQLEENNNRFISVDEDSSGNQEEQEEDEEHAGEQDEEDEEEEEMDQESDDFDQSDDSSREDEHTHTNSVTNSSSIVDLPVHQLSSPFYTKTTKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITS
(1-227 aa encoded by NM_001349798) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
| Species | Title |
|---|---|
Dev Cell ATG5 attenuates inflammatory signaling in mouse embryonic stem cells to control differentiation |
