Recombinant human FAS protein
Cat no : Ag17613
Synonyms
FAS, ALPS1A, APO-1, Apo-1 antigen, Apoptosis-mediating surface antigen FAS
Validation Data Gallery View All
Product Information
Peptide Sequence |
ECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV
(156-335 aa encoded by BC012479) |
Activity | Not tested. |
Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
Species | Title |
---|---|
Nanoscale Res Lett Cytotoxicity induced by nanobacteria and nanohydroxyapatites in human choriocarcinoma cells. |