Recombinant human DIDO1 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Species
human
Cat no : Ag0237
Synonyms
DIDO1, BYE1, C20orf158, DATF 1, DATF1
Validation Data Gallery View All
Product Information
| Peptide Sequence |
ADGTDCTSIGTIEQKSSEDQGIKGRIEKAANPSGKKKLKIFQPVIEAPGASKCIGPGCCHVAQPDSVYCSNDCILKHAAATMKFLSSGKEQKPKPKEKMKMKPEKPSLPKCGAQAGIKISSVHKRPAPEKKETTVKKAVVVPARSEALGKEAACESSTPSWASDHNYNAVKPEKTAAPSPSLLYKCSGKYLYSLHPSLIA
(345-544 aa encoded by BC000770) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
