Recombinant human DERL2 protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Liquid
Species
human
Cat no : Ag14811
Synonyms
DERL2, Derlin-2, CGI 101, Der1 like protein 2, DER2
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGFN
(1-70 aa encoded by BC010890) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
