Recombinant mouse Cxcl12 protein
Cat no : Ag21712
Synonyms
AI174028; PBSF; PBSF/SDF-1; SDF-1; Scyb12; Sdf1; Sdf1a; Sdf1b; TLSF; TLSF-a; TLSF-b; TPAR1
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MDAKVVAVLALVLAALCISDGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
(1-89 aa encoded by BC020297) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
| Species | Title |
|---|---|
Cell Signal Enriched environment enhances angiogenesis in ischemic stroke through SDF-1/CXCR4/AKT/mTOR pathway |
