Recombinant human CSF2 protein
Cat no : Ag12142
Synonyms
CSF2, GM-CSF, Colony stimulating factor, Colony Stimulating Factor 2, Colony-stimulating factor
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
(1-144 aa encoded by BC108724) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
| Species | Title |
|---|---|
Cell Signal Casein Kinase 2 Interacting Protein-1 regulates M1 and M2 inflammatory macrophage polarization. |
