Recombinant human CLDN2 protein
Cat no : Ag25527
Synonyms
Validation Data Gallery View All
Product Information
Peptide Sequence |
SCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV
(184-230 aa encoded by BC014424) |
Activity | Not tested. |
Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
Species | Title |
---|---|
Mol Immunol Effects of cigarette smoke on the aggravation of ovalbumin-induced asthma and the expressions of TRPA1 and tight junctions in mice. |