Recombinant human C6orf125 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Species
human
Cat no : Ag22710
Synonyms
C6orf125, Breast cancer-associated protein SGA-81M, Mitochondrial nucleoid factor 1, Mitochondrial protein M19, MNF1
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MAASRYRRFLKLCEEWPVDETKRGRDLGAYLRQRVAQAFREGENTQVAEPEACDQMYESLARLHSNYYKHKYPRPRDTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEEDHKA
(1-126 aa encoded by BC006007) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
