Recombinant human C16orf63 protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Liquid
Species
human
Cat no : Ag24071
Synonyms
C16orf63, CEP20, FOR20, Centrosomal protein 20, FGFR1OP N-terminal-like protein
Validation Data Gallery View All
Product Information
| Peptide Sequence |
AEVFNALDDDREPRPSLSHENLLINELIREYLEFNKYKYTASVLIAESGQPVVPLDRQFLIHELNAFEESKDNTIPLLYGILAHFLRGTKDGIQNAFLKGPSLQPSDPSLGRQPSRRKPMDDHLRKEEQKSTNIEDLHVSQAVNR
(30-174 aa encoded by BC022321) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
