Recombinant human Beclin 1 protein
Cat no : Ag26557
Synonyms
BECN1, ATG 6, ATG6, Beclin 1, Beclin1
Validation Data Gallery View All
Product Information
Peptide Sequence |
TDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK
(141-450 aa encoded by BC010276) |
Activity | Not tested. |
Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
Species | Title |
---|---|
Nat Commun Oxygen-sensitive methylation of ULK1 is required for hypoxia-induced autophagy. |