Recombinant human ATP1B2 protein
Cat no : Ag17818
Synonyms
ATP1B2, Adhesion molecule in glia, ATPase Na+/K+ beta 2, Sodium/potassium-dependent ATPase subunit beta-2, Sodium/potassium-transporting ATPase subunit beta-2
Validation Data Gallery View All
Product Information
Peptide Sequence |
QTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGY
(64-171 aa encoded by BC126175) |
Activity | Not tested. |
Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
Species | Title |
---|---|
J Appl Physiol (1985) Cold-water immersion after training sessions: effects on fiber type-specific adaptations in muscle K+ transport proteins to sprint-interval training in men. |