Recombinant human ATM protein
Source
e coli.-derived, PKG
Tag
GST
Format
Liquid
Species
human
Cat no : Ag15123
Synonyms
ATM, A T mutated, A-T mutated, EC:2.7.11.1, Serine-protein kinase ATM
Validation Data Gallery View All
Product Information
| Peptide Sequence |
IDHLFISNLPEIVVELLMTLHEPANSSASQSTDLCDFSGDLDPAPNPPHFPSHVVKATFAYISNCHKTKLKSILEILSKSPDSYQKILLAICEQAAETNNVYKKHRILKIYHLFVSLLLKDIKSGLGGAWAFVLRDVIYTLIHYINQR
(1332-1479 aa encoded by BC007023) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
